PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Migut.K00687.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Phrymaceae; Erythranthe
Family Trihelix
Protein Properties Length: 350aa    MW: 39682.1 Da    PI: 5.7001
Description Trihelix family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Migut.K00687.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1trihelix79.64.4e-2547127286
          trihelix   2 WtkqevlaLiearremeerlrrgklkkplWeevskkmrergferspkqCkekwenlnkrykkikegekkrtsessstcpyfdqle 86 
                       W ++e++aLi +r+e+++ ++++k++k+lWe +s +mrergf rsp++C++kw+nl k+ykk k+++++  +   s++ y+++++
  Migut.K00687.1.p  47 WVQEEIRALISLRKETDSMFNTSKSNKHLWENISLNMRERGFDRSPTMCTDKWRNLLKEYKKSKQNDGN--CY--SKMNYYKDID 127
                       ******************************************************************998..43..4588999987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS500908.14239103IPR017877Myb-like domain
Gene3DG3DSA:1.10.10.602.9E-440108IPR009057Homeodomain-like
SMARTSM007171.5E-443105IPR001005SANT/Myb domain
CDDcd122031.93E-2745110No hitNo description
PfamPF138373.7E-1946129No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 350 aa     Download sequence    Send to blast
MIYPPPSQSR LLLTDGGGAA AEAGTHISSN PPPSSAAAPP KKRAETWVQE EIRALISLRK  60
ETDSMFNTSK SNKHLWENIS LNMRERGFDR SPTMCTDKWR NLLKEYKKSK QNDGNCYSKM  120
NYYKDIDQIL RGRSNNSGGG NHSGESKVDP FMQFADKGID DASLNFGPVE ANVERRNSDH  180
EENHPLAITA SGVSPWNWRD TPGNAGEESN TYGGRVIAVK MGEYTKRIGI DGNAEAIKEA  240
IKSAFRLRTN RPFWLEDEYN VVRTVDRDMP LGNYTLHFDE GLTIKICCYE ESEQLPVHTE  300
EKTFYREDDF RDFLSRHGWT CLREYDGFRN VDCLDELCPG DIYRGVNQL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2jmw_A5e-3741125186DNA binding protein GT-1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012851332.10.0PREDICTED: trihelix transcription factor GT-1 isoform X1
SwissprotQ9FX531e-137TGT1_ARATH; Trihelix transcription factor GT-1
TrEMBLA0A022QFE40.0A0A022QFE4_ERYGU; Uncharacterized protein (Fragment)
STRINGGLYMA11G37390.21e-148(Glycine max)
STRINGGLYMA18G01360.11e-149(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA51132136
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G13450.11e-134Trihelix family protein